EpCAM antibody (Middle Region)

Catalog No. ABIN4886570

Product Details anti-EpCAM Antibody

Target: EpCAM (EPCAM) (Epithelial Cell Adhesion Molecule (EPCAM))

Binding Specificity: AA 147-189, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EpCAM antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Epithelial cell adhesion molecule(EPCAM) detection. Tested with WB, IHC-P, ELISA, FCM in Human.

Sequence: ELKHKAREKP YDSKSLRTAL QKEITTRYQL DPKFITSILY ENN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Epithelial cell adhesion molecule(EPCAM) detection. Tested with WB, IHC-P, ELISA, FCM in Human.
Gene Name: epithelial cell adhesion molecule
Protein Name: Epithelial cell adhesion molecule

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Flow Cytometry: Concentration:1-3 μg/1x106 cells, Tested Species: Human
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-EpCAM antibody (ABIN4886570)

Huang, Li, Pan, Cheng, Ren, Jia, Ma, Xu: "A novel multi-target RNAi adenovirus inhibits hepatoma cell proliferation, migration, and induction of angiogenesis." in: Oncotarget, Vol. 7, Issue 36, pp. 57705-57713, (2018) (PubMed).

Zhang, Bu, Sun, Xu, Yao, He, Lai: "Paracrine effects of human amniotic epithelial cells protect against chemotherapy-induced ovarian damage." in: Stem cell research & therapy, Vol. 8, Issue 1, pp. 270, (2018) (PubMed).

Target Details for EpCAM

Target: EpCAM (EPCAM) (Epithelial Cell Adhesion Molecule (EPCAM))

Alternative Name: EPCAM (EPCAM Products)

Synonyms: DIAR5 antibody, EGP-2 antibody, EGP314 antibody, EGP40 antibody, ESA antibody, HNPCC8 antibody, KS1/4 antibody, KSA antibody, M4S1 antibody, MIC18 antibody, MK-1 antibody, TACSTD1 antibody, TROP1 antibody, ECS-1 antibody, ECS1 antibody, ESA1 antibody, M17S1 antibody, EGP antibody, Ep-CAM antibody, sb:cb6 antibody, tacstd antibody, wu:fj17g02 antibody, zgc:110304 antibody, zgc:77119 antibody, tacstd1 antibody, MGC80540 antibody, EPCAM antibody, egp antibody, ksa antibody, m4s1 antibody, mk-1 antibody, cd326 antibody, egp40 antibody, mic18 antibody, trop1 antibody, ep-cam antibody, hegp-2 antibody, co17-1a antibody, ga733-2 antibody, CD326 antibody, Egp314 antibody, EpCAM1 antibody, GA733-2 antibody, Ly74 antibody, Tacsd1 antibody, Tacstd1 antibody, gp40 antibody, epithelial cell adhesion molecule antibody, flotillin 2 antibody, epithelial cell adhesion molecule S homeolog antibody, EPCAM antibody, FLOT2 antibody, epcam antibody, epcam.S antibody, Epcam antibody

Background: Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell-cell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.

Synonyms: AUA1 | CD326 | CD326 antigen | CO 17A | CO17 1A | CO17A | DIAR5 | EGP 2 | EGP | EGP2 | EGP314 | EGP40 | Ep CAM | EpCAM |Ep-CAM | Epithelial glycoprotein | ESA | GA733 1 | GA733 2 | GA733-2 | KS1/4 | M1S 1 | M1S2 | M4S1 | MIC18 | MK 1 | TACD1 | TACSTD1 | TROP1 | P16422

Gene ID: 4072

UniProt: P16422