Surfactant Protein A1 antibody

Catalog No. ABIN4952536

The Rabbit Polyclonal anti-Surfactant Protein A1 antibody is suitable to detect Surfactant Protein A1 in samples from Human, Rat and Mouse. It has been validated for WB, IHC (p), IF and IHC (fro).

Quick Overview for Surfactant Protein A1 antibody (ABIN4952536)

Target: Surfactant Protein A1 (SFTPA1)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Surfactant Protein A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Immunohistochemistry (Frozen Sections) (IHC (fro))

Product Details anti-Surfactant Protein A1 Antibody

Purpose: SFTPA1/2 Antibody

Sequence: VNYTNWYRGE PAGRGKEQCV EMYTDGQWND RN

Purification: Antigen affinity

Immunogen: Amino acids VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN of human SFTPA1/2 were used as the immunogen for the SFTPA1/2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SFTPA1/2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the SFTPA1/2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for Surfactant Protein A1

Target: Surfactant Protein A1 (SFTPA1)

Alternative Name: SFTPA1/2

Background: SFTPA1/2 is also known as SP-A. SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. SFTPA2 is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.

UniProt: Q8IWL1