SLUG antibody

Catalog No. ABIN4952602

The Rabbit Polyclonal anti-SLUG antibody is suitable to detect SLUG in samples from Human, Mouse and Rat. It has been validated for WB and IHC (p).

Quick Overview for SLUG antibody (ABIN4952602)

Target: SLUG (SNAI2) (Snail Family Zinc Finger 2 (SNAI2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLUG antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-SLUG Antibody

Purpose: SLUG Antibody / SNAI2

Sequence: KLSDPHAIEA EKFQCNLCNK TYSTFSGLAK HKQ

Purification: Antigen affinity

Immunogen: Amino acids KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ of human SLUG were used as the immunogen for the SLUG antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SLUG antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the SLUG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for SLUG

Target: SLUG (SNAI2) (Snail Family Zinc Finger 2 (SNAI2))

Alternative Name: SLUG

Background: SLUG is also known as SNAI2. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.

UniProt: O43623