TMPRSS2 antibody (Transmembrane Protease, serine 2) (AA 383-492) Primary Antibody
-
- Target
- TMPRSS2
- Binding Specificity
-
AA 383-492
- Reactivity
-
Human
- Host
- Mouse
- Clonality
- Monoclonal
- Conjugate
-
This TMPRSS2 antibody is un-conjugated
- Application
-
ELISA, Western Blotting (WB)
- Purpose
- Mouse monoclonal antibody raised against a partial recombinant TMPRSS2.
- Cross-Reactivity
- Human
- Immunogen
-
immunogen: TMPRSS2 (NP_005647, 383 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
- Clone
- 2F4
- Isotype
- IgG2a kappa
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- TMPRSS2
- Alternative Name
- TMPRSS2 (TMPRSS2 Antibody Abstract)
- Synonyms
- PP9284, PRSS10, D16Ertd61e, transmembrane protease serine 2-like, transmembrane protease, serine 2, LOC100739411, TMPRSS2, Tmprss2
- Background
-
Full Gene Name: transmembrane protease, serine 2
Synonyms: FLJ41954,PP9284,PRSS10 - Gene ID
- 7113
- NCBI Accession
- NP_005647, NM_005656