TMPRSS2 antibody (Transmembrane Protease, serine 2) (AA 383-492) Primary Antibody
TMPRSS2
Reactivity: Human
ELISA, WB
Host: Mouse
Monoclonal
2F4
camera_alt 1
Catalog No. ABIN521006
$440.00
Plus shipping costs $45.00
100 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 383-492
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Monoclonal
- Conjugate
- This TMPRSS2 antibody is un-conjugated
- Application
- ELISA, Western Blotting (WB)
- Purpose
- Mouse monoclonal antibody raised against a partial recombinant TMPRSS2.
- Cross-Reactivity
- Human
- Immunogen
immunogen: TMPRSS2 (NP_005647, 383 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
- Clone
- 2F4
- Isotype
- IgG2a kappa
-
- Target
- Alternative Name
- TMPRSS2 (TMPRSS2 Antibody Abstract)
- Background
- Full Gene Name: transmembrane protease, serine 2
Synonyms: FLJ41954,PP9284,PRSS10 - Gene ID
- 7113
- NCBI Accession
- NP_005647, NM_005656
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
You are here:
