Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

TMPRSS2 antibody (Transmembrane Protease, serine 2) (AA 383-492) Primary Antibody

TMPRSS2 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 2F4 unconjugated
Catalog No. ABIN521006
$440.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    TMPRSS2
    Binding Specificity
    AA 383-492
    • 8
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 51
    • 26
    • 19
    • 1
    • 1
    • 1
    Host
    Mouse
    Clonality
    Monoclonal
    Conjugate
    This TMPRSS2 antibody is un-conjugated
    • 26
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    ELISA, Western Blotting (WB)
    • 38
    • 16
    • 13
    • 8
    • 4
    • 4
    • 3
    • 2
    • 2
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant TMPRSS2.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: TMPRSS2 (NP_005647, 383 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

    Clone
    2F4
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    TMPRSS2
    Alternative Name
    TMPRSS2 (TMPRSS2 Antibody Abstract)
    Synonyms
    PP9284, PRSS10, D16Ertd61e, transmembrane protease serine 2-like, transmembrane protease, serine 2, LOC100739411, TMPRSS2, Tmprss2
    Background
    Full Gene Name: transmembrane protease, serine 2
    Synonyms: FLJ41954,PP9284,PRSS10
    Gene ID
    7113
    NCBI Accession
    NP_005647, NM_005656
You are here:
help Support