TMPRSS2 antibody (Transmembrane Protease, serine 2) (AA 383-492)

Catalog No. ABIN521006

Product Details anti-TMPRSS2 Antibody

Target: TMPRSS2

See all TMPRSS2 Antibodies

Binding Specificity: AA 383-492

See all available epitopes across TMPRSS2 antibodies

• Internal Region 8
• N-Term 4
• AA 320-370 3
• AA 1-492 2
• AA 314-343 2
• AA 470-530 2
• C-Term 2
• Center 2
• Middle Region 2
• AA 1-30 1
• AA 140-400 1
• AA 254-490 1
• AA 284-492 1
• AA 383-492 1
• AA 383-493 1
• Ser2 1
• full length 1

Reactivity: Human

See all available reactivities across TMPRSS2 antibodies

• Human 51
• Mouse 26
• Rat 19
• Cow 1
• Pig 1
• Rabbit 1

Host: Mouse

Clonality: Monoclonal

Conjugate: This TMPRSS2 antibody is un-conjugated

See all available conjugates across TMPRSS2 antibodies

• Un-conjugated 26
• Biotin 4
• FITC 3
• Alexa Fluor 594 2
• Alexa Fluor 680 2
• Alexa Fluor 750 2
• HRP 2
• APC 1
• Alexa Fluor 350 1
• Alexa Fluor 488 1
• Alexa Fluor 555 1
• Alexa Fluor 647 1
• Alkaline Phosphatase (AP) 1
• Cy3 1
• Cy5 1
• Cy5.5 1
• Cy7 1
• PE 1

Application: ELISA, Western Blotting (WB)

See all available applications across TMPRSS2 antibodies

• Western Blotting (WB) 38
• ELISA 16
• Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13
• Immunohistochemistry (IHC) 8
• Flow Cytometry (FACS) 4
• Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 4
• Immunoprecipitation (IP) 3
• Enzyme Immunoassay (EIA) 2
• Immunocytochemistry (ICC) 2

Purpose: Mouse monoclonal antibody raised against a partial recombinant TMPRSS2.

Cross-Reactivity: Human

Immunogen:

immunogen: TMPRSS2 (NP_005647, 383 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Clone: 2F4

Isotype: IgG2a kappa

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Buffer: In 1x PBS, pH 7.4

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details for TMPRSS2

Target: TMPRSS2

Alternative Name: TMPRSS2 (TMPRSS2 Antibody Abstract)

Synonyms: PP9284, PRSS10, D16Ertd61e, transmembrane protease serine 2-like, transmembrane protease, serine 2, LOC100739411, TMPRSS2, Tmprss2

Background: Full Gene Name: transmembrane protease, serine 2
Synonyms: FLJ41954,PP9284,PRSS10

Gene ID: 7113

NCBI Accession: NP_005647, NM_005656