MTRF1 antibody (Mitochondrial Translational Release Factor 1) (AA 1-151)

Details for Product anti-MTRF1 Antibody No. ABIN523108
Target
Binding Specificity
AA 1-151
15
9
8
7
7
4
1
1
1
Reactivity
Human
49
16
15
Host
Mouse
38
11
Clonality
Polyclonal
Conjugate
This MTRF1 antibody is un-conjugated
5
4
4
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
27
24
13
5
3
2
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human MTRF1 protein.
Brand MaxPab®
Immunogen

immunogen: MTRF1 (ENSP00000239852, 1 a.a. ~ 151 a.a) full-length human protein.

Immunogen Sequence: MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKKTESCSVAQAGMQ

Cross-Reactivity Human
Target
Alternative Name MTRF1 (MTRF1 Antibody Abstract)
Background Full Gene Name: mitochondrial translational release factor 1
Synonyms: MGC47721,MRF1,MTTRF1,RF1
Gene ID 9617
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Mitochondrial Translational Release Factor 1 (MTRF1) (AA 1-151) antibody (ABIN523108) Western Blot analysis of MTRF1 expression in transfected 293T cell line by MTRF1 MaxP...
Image no. 2 for anti-Mitochondrial Translational Release Factor 1 (MTRF1) (AA 1-151) antibody (ABIN523108) MTRF1 MaxPab polyclonal antibody. Western Blot analysis of MTRF1 expression in human ...
Product cited in: Jeon, Jeong, Baek, Koo, Park, Yang, Yu, Kim, Pak: "Network clustering revealed the systemic alterations of mitochondrial protein expression." in: PLoS computational biology, Vol. 7, Issue 6, pp. e1002093, 2011 (PubMed).