Interferon-Induced Transmembrane Protein 3 (IFITM3) (AA 1-133) antibody

Catalog No. ABIN523801

Product Details

Target:

Interferon-Induced Transmembrane Protein 3 (IFITM3)

Binding Specificity: AA 1-133

Reactivity: Human

Host: Mouse

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Purpose: Mouse polyclonal antibody raised against a full-length human IFITM3 protein.

Brand: MaxPab®

Cross-Reactivity: Human

Immunogen:

immunogen: IFITM3 (NP_066362.1, 1 a.a. ~ 133 a.a) full-length human protein.

Immunogen Sequence: MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG

Target Details

Target:

Interferon-Induced Transmembrane Protein 3 (IFITM3)

Alternative Name: IFITM3 (IFITM3 Antibody Abstract)

Background: Full Gene Name: interferon induced transmembrane protein 3 (1-8U)
Synonyms: 1-8U,IP15

Gene ID: 10410

NCBI Accession: NP_066362, NM_021034

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: No additive

Preservative: Without preservative

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Jia, Pan, Ding, Rong, Liu, Geng, Qiao, Liang: "The N-terminal region of IFITM3 modulates its antiviral activity by regulating IFITM3 cellular localization." in: Journal of virology, Vol. 86, Issue 24, pp. 13697-707, 2012 (PubMed).

Tatro, Scott, Nguyen, Salaria, Banerjee, Moore, Masliah, Achim, Everall: "Evidence for Alteration of Gene Regulatory Networks through MicroRNAs of the HIV-infected brain: novel analysis of retrospective cases." in: PLoS ONE, Vol. 5, Issue 4, pp. e10337, 2010 (PubMed).