Interferon-Induced Transmembrane Protein 3 (IFITM3) (AA 1-133) antibody Primary Antibody
IFITM3
Reactivity: Human
WB
Host: Mouse
Polyclonal
unconjugated
camera_alt 2
Catalog No. ABIN523801
$440.00
Plus shipping costs $45.00
50 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Interferon-Induced Transmembrane Protein 3 (IFITM3)
- Binding Specificity
- AA 1-133
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Conjugate
- Un-conjugated
- Application
- Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a full-length human IFITM3 protein.
- Brand
- MaxPab®
- Cross-Reactivity
- Human
- Immunogen
immunogen: IFITM3 (NP_066362.1, 1 a.a. ~ 133 a.a) full-length human protein.
Immunogen Sequence: MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- No additive
- Preservative
- Without preservative
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
-
Jia, Pan, Ding, Rong, Liu, Geng, Qiao, Liang: "The N-terminal region of IFITM3 modulates its antiviral activity by regulating IFITM3 cellular localization." in: Journal of virology, Vol. 86, Issue 24, pp. 13697-707, 2012 (PubMed).
Tatro, Scott, Nguyen, Salaria, Banerjee, Moore, Masliah, Achim, Everall: "Evidence for Alteration of Gene Regulatory Networks through MicroRNAs of the HIV-infected brain: novel analysis of retrospective cases." in: PLoS ONE, Vol. 5, Issue 4, pp. e10337, 2010 (PubMed).
-
Jia, Pan, Ding, Rong, Liu, Geng, Qiao, Liang: "The N-terminal region of IFITM3 modulates its antiviral activity by regulating IFITM3 cellular localization." in: Journal of virology, Vol. 86, Issue 24, pp. 13697-707, 2012 (PubMed).
-
- Target
- Interferon-Induced Transmembrane Protein 3 (IFITM3)
- Alternative Name
- IFITM3 (IFITM3 Antibody Abstract)
- Synonyms
- 1110004C05Rik, Cd225, Cdw217, DSPA2b, Fgls, IP15, mil-1, 1-8U, rat8, Interferon-induced transmembrane protein 3, interferon induced transmembrane protein 3, ifm3, Ifitm3, IFITM3
- Background
- Full Gene Name: interferon induced transmembrane protein 3 (1-8U)
Synonyms: 1-8U,IP15 - Gene ID
- 10410
- NCBI Accession
- NP_066362, NM_021034
You are here: