Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Interferon-Induced Transmembrane Protein 3 (IFITM3) (AA 1-133) antibody Primary Antibody

IFITM3 Reactivity: Human IP, ELISA, WB Host: Mouse Monoclonal 2H4-1D5 unconjugated
Catalog No. ABIN523806
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Interferon-Induced Transmembrane Protein 3 (IFITM3)
    Binding Specificity
    • 8
    • 5
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-133
    Reactivity
    • 38
    • 7
    • 7
    • 1
    • 1
    • 1
    Human
    Host
    • 31
    • 4
    • 3
    Mouse
    Clonality
    • 35
    • 3
    Monoclonal
    Conjugate
    • 26
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Un-conjugated
    Application
    • 30
    • 19
    • 11
    • 10
    • 6
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Immunoprecipitation (IP), ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a full-length recombinant IFITM3.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG

    Clone
    2H4-1D5
    Isotype
    IgG1 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Interferon-Induced Transmembrane Protein 3 (IFITM3)
    Alternative Name
    IFITM3 (IFITM3 Antibody Abstract)
    Synonyms
    1110004C05Rik, Cd225, Cdw217, DSPA2b, Fgls, IP15, mil-1, 1-8U, rat8, Interferon-induced transmembrane protein 3, interferon induced transmembrane protein 3, ifm3, Ifitm3, IFITM3
    Background
    Full Gene Name: interferon induced transmembrane protein 3 (1-8U)
    Synonyms: 1-8U,IP15
    Gene ID
    10410
You are here:
help Support