Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CXCL13 antibody (Chemokine (C-X-C Motif) Ligand 13) (AA 1-109) Primary Antibody

CXCL13 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN523990
$600.00
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    CXCL13
    Binding Specificity
    • 10
    • 6
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-109
    Reactivity
    • 49
    • 10
    • 3
    • 1
    Human
    Host
    • 47
    • 7
    • 1
    • 1
    • 1
    Mouse
    Clonality
    • 55
    • 2
    Polyclonal
    Conjugate
    • 28
    • 6
    • 5
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This CXCL13 antibody is un-conjugated
    Application
    • 32
    • 28
    • 14
    • 11
    • 8
    • 5
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length human CXCL13 protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: CXCL13 (NP_006410, 1 a.a. ~ 109 a.a) full-length human protein.

    Immunogen Sequence: MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    No additive
    Preservative
    Without preservative
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    CXCL13
    Alternative Name
    CXCL13 (CXCL13 Antibody Abstract)
    Synonyms
    4631412M08Rik, ANGIE2, Angie, BCA-1, BLC, BLR1L, Scyb13, ANGIE, BCA1, SCYB13, C-X-C motif chemokine ligand 13, chemokine (C-X-C motif) ligand 13, Cxcl13, CXCL13
    Background
    Full Gene Name: chemokine (C-X-C motif) ligand 13
    Synonyms: ANGIE,ANGIE2,BCA-1,BCA1,BLC,BLR1L,SCYB13
    Gene ID
    10563
    NCBI Accession
    NP_006410, NM_006419
You are here:
help Support