Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

G Substrate (Gsbs) (AA 1-155) antibody Primary Antibody

Gsbs Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN524246
$425.71
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    G Substrate (Gsbs)
    Binding Specificity
    AA 1-155
    • 3
    • 2
    • 2
    • 1
    Reactivity
    Human
    • 8
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Application
    Western Blotting (WB)
    • 8
    • 2
    • 2
    Purpose
    Rabbit polyclonal antibody raised against a full-length human C7orf16 protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: C7orf16 (NP_006649.1, 1 a.a. ~ 155 a.a) full-length human protein.

    Immunogen Sequence: MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    G Substrate (Gsbs)
    Alternative Name
    C7orf16 (Gsbs Antibody Abstract)
    Synonyms
    C7orf16, GSBS, Gsbs, Ppp1r2, protein phosphatase 1 regulatory subunit 17, protein phosphatase 1, regulatory subunit 17, PPP1R17, Ppp1r17
    Background
    Full Gene Name: chromosome 7 open reading frame 16
    Synonyms: GSBS
    Gene ID
    10842
    NCBI Accession
    NP_006649, NM_006658
You are here:
help Support