G Substrate (Gsbs) (AA 1-155) antibody

Details for Product No. ABIN524246
Target
Binding Specificity
AA 1-155
3
2
2
1
Reactivity
Human
8
2
2
2
1
1
1
1
1
Host
Rabbit
4
4
Clonality
Polyclonal
Application
Western Blotting (WB)
8
2
2
Options
Purpose Rabbit polyclonal antibody raised against a full-length human C7orf16 protein.
Brand MaxPab®
Immunogen

immunogen: C7orf16 (NP_006649.1, 1 a.a. ~ 155 a.a) full-length human protein.

Immunogen Sequence: MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI

Cross-Reactivity Human
Target
Alternative Name C7orf16 (Gsbs Antibody Abstract)
Background Full Gene Name: chromosome 7 open reading frame 16
Synonyms: GSBS
Gene ID 10842
NCBI Accession NP_006649, NM_006658
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-G Substrate (Gsbs) (AA 1-155) antibody (ABIN524246) Western Blot analysis of C7orf16 expression in transfected 293T cell line by C7orf16 ...