Protocadherin gamma Subfamily A, 2 (PCDHGA2) (AA 223-331) antibody

Details for Product No. ABIN527859
Antigen
Epitope
AA 223-331
2
1
1
Reactivity
Human
5
Host
Mouse
4
1
Clonality (Clone)
Monoclonal ()
Application
ELISA, Western Blotting (WB)
5
4
2
1
1
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant PCDHGA2.
Immunogen

immunogen: PCDHGA2 (NP_061738, 223 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: SGTSRICVKVLDANDNAPVFTQPEYRISIPENTLVGTRILTVTATDADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDIEAQDGPGLLTRA

Clone 2A7
Isotype IgG2a kappa
Cross-Reactivity Human, Mouse (Murine)
Antigen
Alternative Name PCDHGA2 (PCDHGA2 Antibody Abstract)
Background Full Gene Name: protocadherin gamma subfamily A, 2
Synonyms: PCDH-GAMMA-A2
Gene ID 56113
NCBI Accession NP_061738, NM_018915
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer In ascites fluid
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Protocadherin gamma Subfamily A, 2 (PCDHGA2) (AA 223-331) antibody (ABIN527859) PCDHGA2 monoclonal antibody (M01A), clone 2A7. Western Blot analysis of PCDHGA2 expre...
Image no. 2 for anti-Protocadherin gamma Subfamily A, 2 (PCDHGA2) (AA 223-331) antibody (ABIN527859) Western Blot analysis of PCDHGA2 expression in transfected 293T cell line by PCDHGA2 ...
Image no. 3 for anti-Protocadherin gamma Subfamily A, 2 (PCDHGA2) (AA 223-331) antibody (ABIN527859) Western Blot detection against Immunogen (37.73 KDa) .