PCDHB10 antibody (Protocadherin beta 10) (AA 27-125)

Details for Product anti-PCDHB10 Antibody No. ABIN527866
Antigen
Epitope
AA 27-125
9
9
8
2
1
1
Reactivity
Human
40
Host
Mouse
37
3
Clonality (Clone)
Monoclonal ()
Conjugate
This PCDHB10 antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunofluorescence (IF), ELISA, Western Blotting (WB)
28
21
17
13
4
3
2
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant PCDHB10.
Immunogen

immunogen: PCDHB10 (NP_061753, 27 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: GSGFGRYSVTEETEKGSFVVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRD

Clone 4C4
Isotype IgG2a kappa
Cross-Reactivity Human, Mouse (Murine)
Antigen
Alternative Name PCDHB10 (PCDHB10 Antibody Abstract)
Background Full Gene Name: protocadherin beta 10
Synonyms: PCDH-BETA10,PCHB10
Gene ID 56126
NCBI Accession NP_061753, NM_018930
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Protocadherin beta 10 (PCDHB10) (AA 27-125) antibody (ABIN527866) PCDHB10 monoclonal antibody (M07), clone 4C4 Western Blot analysis of PCDHB10 express...
Image no. 2 for anti-Protocadherin beta 10 (PCDHB10) (AA 27-125) antibody (ABIN527866) Immunofluorescence of monoclonal antibody to PCDHB10 on HeLa cell. [antibody concentr...
Image no. 3 for anti-Protocadherin beta 10 (PCDHB10) (AA 27-125) antibody (ABIN527866) Western Blot detection against Immunogen (36.63 KDa) .
Product cited in: Balagurunathan, Morse, Hostetter, Shanmugam, Stafford, Shack, Pearson, Trissal, Demeure, Von Hoff, Hruby, Gillies, Han: "Gene expression profiling-based identification of cell-surface targets for developing multimeric ligands in pancreatic cancer." in: Molecular cancer therapeutics, Vol. 7, Issue 9, pp. 3071-80, 2008 (PubMed).