PCDHB10 antibody (Protocadherin beta 10) (AA 27-125)

Details for Product anti-PCDHB10 Antibody No. ABIN565997
Antigen
Epitope
AA 27-125
9
9
8
2
1
1
Reactivity
Human
40
Host
Mouse
37
3
Clonality
Polyclonal
Conjugate
This PCDHB10 antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
28
21
17
13
4
3
3
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant PCDHB10.
Immunogen

immunogen: PCDHB10 (NP_061753, 27 a.a. ~ 125 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: GSGFGRYSVTEETEKGSFVVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRD

Cross-Reactivity Human
Antigen
Alternative Name PCDHB10 (PCDHB10 Antibody Abstract)
Background Full Gene Name: protocadherin beta 10
Synonyms: PCDH-BETA10,PCHB10
Gene ID 56126
NCBI Accession NP_061753, NM_018930
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Protocadherin beta 10 (PCDHB10) (AA 27-125) antibody (ABIN565997) Western Blot detection against Immunogen (37 KDa) .
Product cited in: Klee, Finlay, McDonald, Attewell, Hebrink, Dyer, Love, Vasmatzis, Li, Beechem, Klee: "Bioinformatics methods for prioritizing serum biomarker candidates." in: Clinical chemistry, Vol. 52, Issue 11, pp. 2162-4, 2007 (PubMed).