N-Acetylglucosamine-1-Phosphate Transferase, gamma Subunit (GNPTG) (AA 19-304) antibody

Details for Product No. ABIN529728
Target
Binding Specificity
AA 19-304
8
8
7
1
1
Reactivity
Human
20
2
2
Host
Mouse
18
2
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Western Blotting (WB)
20
15
2
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human GNPTG protein.
Brand MaxPab®
Immunogen

immunogen: GNPTG (AAH14592, 19 a.a. ~ 304 a.a) full-length human protein.

Immunogen Sequence: PAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDRVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL

Cross-Reactivity Human
Target
Alternative Name GNPTG (GNPTG Antibody Abstract)
Background Full Gene Name: N-acetylglucosamine-1-phosphate transferase, gamma subunit
Synonyms: C16orf27,GNPTAG,LP2537,RJD9
Gene ID 84572
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-N-Acetylglucosamine-1-Phosphate Transferase, gamma Subunit (GNPTG) (AA 19-304) antibody (ABIN529728) Western Blot analysis of GNPTG expression in transfected 293T cell line by GNPTG MaxP...