N-Acetylglucosamine-1-Phosphate Transferase, gamma Subunit (GNPTG) (AA 19-304) antibody Primary Antibody
GNPTG
Reactivity: Human
WB
Host: Mouse
Polyclonal
unconjugated
camera_alt 1
Catalog No. ABIN529728
$440.00
Plus shipping costs $45.00
50 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- N-Acetylglucosamine-1-Phosphate Transferase, gamma Subunit (GNPTG)
- Binding Specificity
- AA 19-304
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Conjugate
- Un-conjugated
- Application
- Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a full-length human GNPTG protein.
- Brand
- MaxPab®
- Cross-Reactivity
- Human
- Immunogen
immunogen: GNPTG (AAH14592, 19 a.a. ~ 304 a.a) full-length human protein.
Immunogen Sequence: PAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDRVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- N-Acetylglucosamine-1-Phosphate Transferase, gamma Subunit (GNPTG)
- Alternative Name
- GNPTG (GNPTG Antibody Abstract)
- Synonyms
- C16orf27, GNPTAG, LP2537, RJD9, Gnptag, 6430527N14Rik, A830081F19, AU067667, AU067744, Mdcp1, Tce7, N-acetylglucosamine-1-phosphate transferase gamma subunit, N-acetylglucosamine-1-phosphate transferase, gamma subunit, N-acetylglucosamine-1-phosphotransferase, gamma subunit, GNPTG, Gnptg
- Background
- Full Gene Name: N-acetylglucosamine-1-phosphate transferase, gamma subunit
Synonyms: C16orf27,GNPTAG,LP2537,RJD9 - Gene ID
- 84572
You are here: