TUBB antibody (Tubulin, beta) (AA 1-444)

Details for Product anti-TUBB Antibody No. ABIN531302
Antigen
  • M40
  • OK/SW-cl.56
  • TUBB1
  • TUBB5
  • XLOT
  • m40
  • ok/sw-cl.56
  • tubb1
  • tubb5
  • TUBB2A
  • TUBB2B
  • TUBB
  • 1t
  • B1t
  • BETA 56D
  • CG9277
  • DTB2
  • Dmbeta1
  • Dmel\\CG9277
  • T
  • Tub
  • Tubulin
  • beta
  • beta-Tub
  • beta-Tub56D
  • beta-tub
  • beta-tubulin56D
  • beta1
  • beta1-Tubulin
  • beta1-tub
  • beta1Tub
  • beta1t
  • beta1tub
  • beta56D
  • betaTub
  • betaTub1
  • beta[[1]] tubulin
  • beta[[1]]-tubulin
  • betatub(56D)
  • 143391_i_at
  • 3t
  • B3t
  • BETA 60D
  • CG3401
  • D.m.BETA-60D
  • DTB3
  • Dmbeta3
  • Dmel\\CG3401
  • Tub60D
  • beta-Tub60D
  • beta-Tub6D
  • beta3
  • beta3 TU
  • beta3-Tub
  • beta3-tubulin
  • beta3TUB
  • beta3Tub
  • beta3t
  • beta60C
  • betaTub3
  • betaTub60C
  • beta[[3]] tubulin
  • beta[[3]]-Tub
  • beta[[3]]-tubulin
  • betatub60D
  • p50
  • p50/tubulin
  • p53
  • p53/tubulin
  • 2t
  • B2t
  • BETA 85D
  • BETA2
  • CG9359
  • D.m.BETA-85D
  • DTB4
  • Dmbeta2
  • Dmel\\CG9359
  • beta(2)Tu
  • beta(2)Tub
  • beta-Tub85D
  • beta-tub85D
  • beta2
  • beta2-tub
  • beta2t
  • beta2tub
  • beta85D
  • betaTub2
  • beta[[2]]-tubulin
  • ms(3)KK[D]
  • 4t
  • B4t
  • BETA 98B
  • CG4869
  • DTB1
  • Dmbeta4
  • Dmel\\CG4869
  • beta-Tub97EF
  • beta4
  • beta4t
  • beta97F
  • betaTub4
  • betaTub98BC
  • betaTub98C
  • Tub1
  • bmtub1
  • Tub3
  • bmtub3
  • Tub2
  • bmtub2
  • Tub4
  • bmtub4
  • LOC100101153
  • tubulin beta class I
  • putative cobalt-zinc-cadmium outer membrane resistance protein
  • Tubulin beta chain
  • tubulin beta-2A chain
  • beta-Tubulin at 56D
  • beta-Tubulin at 60D
  • beta-Tubulin at 85D
  • beta-Tubulin at 97EF
  • beta-tubulin
  • beta tubulin
  • tubulin beta class I L homeolog
  • tubulin, beta 5 class I
  • TUBB
  • czcC
  • tbb-6
  • tubb
  • LOC462399
  • betaTub56D
  • betaTub60D
  • betaTub85D
  • betaTub97EF
  • Tub1
  • Tub3
  • Tub2
  • Tub4
  • TVAG_525430
  • TVAG_062880
  • TVAG_456920
  • LOC100101153
  • Tb927.1.2330
  • Tb927.1.2350
  • Tb927.1.2370
  • Tb927.1.2390
  • tubb.L
  • Tubb
  • LOC693049
  • LOC443015
  • Tubb5
Epitope
AA 1-444
22
21
15
15
8
6
4
4
4
4
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
325
229
213
32
30
29
27
24
20
19
17
12
11
9
8
8
7
7
4
4
3
3
3
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Host
Mouse
186
182
1
1
1
1
Clonality (Clone)
Monoclonal ()
Conjugate
This TUBB antibody is un-conjugated
10
10
8
8
8
8
8
8
6
3
3
3
3
3
2
2
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
287
105
98
76
57
40
37
23
22
13
8
7
3
3
2
2
1
1
1
Options
Purpose Mouse monoclonal antibody raised against a full-length recombinant TUBB.
Immunogen

immunogen: TUBB (AAH19924, 1 a.a. ~ 444 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA

Clone 3B3
Isotype IgG2a kappa
Cross-Reactivity Human
Plasmids, Primers & others Plasmids, Primers & others TUBB products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name TUBB (TUBB Antibody Abstract)
Background Full Gene Name: tubulin, beta
Synonyms: M40,MGC117247,MGC16435,OK/SW-cl.56,TUBB1,TUBB5
Gene ID 203068
Pathways Microtubule Dynamics, M Phase
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Tubulin, beta (TUBB) (AA 1-444) antibody (ABIN531302) TUBB monoclonal antibody (M04), clone 3B3. Western Blot analysis of TUBB expression i...
Image no. 2 for anti-Tubulin, beta (TUBB) (AA 1-444) antibody (ABIN531302) Immunoperoxidase of monoclonal antibody to TUBB on formalin-fixed paraffin-embedded h...
Image no. 3 for anti-Tubulin, beta (TUBB) (AA 1-444) antibody (ABIN531302) Detection limit for recombinant GST tagged TUBB is 1 ng/ml as a capture antibody.
Image no. 4 for anti-Tubulin, beta (TUBB) (AA 1-444) antibody (ABIN531302) Western Blot detection against Immunogen (74.36 KDa) .
Product cited in: Walter, Beránek, Fischermeier, Diez: "Tubulin acetylation alone does not affect kinesin-1 velocity and run length in vitro." in: PLoS ONE, Vol. 7, Issue 8, pp. e42218, 2012 (PubMed).

Op De Beéck, Van den Bergh, Vermeire, Decock, Derua, Waelkens, Rutgeerts, Nevens, Bossuyt: "Immune reactivity to ?-tubulin isotype 5 and vesicular integral-membrane protein 36 in patients with autoimmune gastrointestinal disorders." in: Gut, Vol. 60, Issue 11, pp. 1601-2, 2011 (PubMed).

Did you look for something else?