Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Creatine Kinase, Brain (CKB) (AA 1-381) antibody Primary Antibody

CKB Reactivity: Human ELISA, WB Host: Mouse Polyclonal unconjugated
Pubmed (1)
Catalog No. ABIN560380
$238.67
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Binding Specificity
    AA 1-381
    Reactivity
    Human
    Host
    Mouse
    Clonality
    Polyclonal
    Conjugate
    Un-conjugated
    Application
    ELISA, Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length recombinant CKB.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: CKB (AAH01190, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag.

    Immunogen Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Hara, Aizaki, Matsuda, Shinkai-Ouchi, Inoue, Murakami, Shoji, Kawakami, Matsuura, Lai, Miyamura, Wakita, Suzuki: "Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein." in: Journal of virology, Vol. 83, Issue 10, pp. 5137-47, 2009 (PubMed).

  • Target
    Alternative Name
    CKB (CKB Antibody Abstract)
    Synonyms
    B-CK, CKBB, b-ck, ckbb, CKB, Bck, Ck-3, Ck3, Ckbb, bck, ckb, cb594, wu:fj36f10, wu:fj37d11, Ckbr, creatine kinase B, creatine kinase, brain L homeolog, creatine kinase B-type, creatine kinase, brain, creatine kinase, brain b, CKB, ckb.L, Ckb, ckb, ckbb
    Background
    Full Gene Name: creatine kinase, brain
    Synonyms: B-CK,CKBB
    Gene ID
    1152
You are here: