Creatine Kinase, Brain (CKB) (AA 1-381) antibody Primary Antibody
CKB
Reactivity: Human
ELISA, WB
Host: Mouse
Polyclonal
unconjugated
camera_alt 1
Catalog No. ABIN560380
$238.67
Plus shipping costs $45.00
50 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-381
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Conjugate
- Un-conjugated
- Application
- ELISA, Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a full-length recombinant CKB.
- Cross-Reactivity
- Human
- Immunogen
immunogen: CKB (AAH01190, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag.
Immunogen Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- 50 % glycerol
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
-
Hara, Aizaki, Matsuda, Shinkai-Ouchi, Inoue, Murakami, Shoji, Kawakami, Matsuura, Lai, Miyamura, Wakita, Suzuki: "Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein." in: Journal of virology, Vol. 83, Issue 10, pp. 5137-47, 2009 (PubMed).
-
Hara, Aizaki, Matsuda, Shinkai-Ouchi, Inoue, Murakami, Shoji, Kawakami, Matsuura, Lai, Miyamura, Wakita, Suzuki: "Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein." in: Journal of virology, Vol. 83, Issue 10, pp. 5137-47, 2009 (PubMed).
-
- Target
- Alternative Name
- CKB (CKB Antibody Abstract)
- Synonyms
- B-CK, CKBB, b-ck, ckbb, CKB, Bck, Ck-3, Ck3, Ckbb, bck, ckb, cb594, wu:fj36f10, wu:fj37d11, Ckbr, creatine kinase B, creatine kinase, brain L homeolog, creatine kinase B-type, creatine kinase, brain, creatine kinase, brain b, CKB, ckb.L, Ckb, ckb, ckbb
- Background
- Full Gene Name: creatine kinase, brain
Synonyms: B-CK,CKBB - Gene ID
- 1152
You are here: