Interferon Regulatory Factor 2 (IRF2) (AA 216-315) antibody

Details for Product No. ABIN561522
Antigen
Epitope
AA 216-315
17
13
11
11
8
8
6
6
4
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
129
77
56
9
9
7
6
6
6
4
3
2
2
1
Host
Mouse
110
11
9
1
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
7
5
4
4
4
3
3
3
3
3
3
3
1
1
1
1
1
1
Application
Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
94
48
33
14
13
7
7
6
6
3
3
2
1
1
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant IRF2.
Immunogen

immunogen: IRF2 (NP_002190, 216 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSS

Clone 3B5
Isotype IgG2a kappa
Cross-Reactivity Human
Antigen
Alternative Name IRF2 (IRF2 Antibody Abstract)
Background Full Gene Name: interferon regulatory factor 2
Synonyms: DKFZp686F0244,IRF-2
Gene ID 3660
NCBI Accession NP_002190, NM_002199
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Interferon Regulatory Factor 2 (IRF2) (AA 216-315) antibody (ABIN561522) Western Blot analysis of IRF2 expression in transfected 293T cell line by IRF2 monocl...
Image no. 2 for anti-Interferon Regulatory Factor 2 (IRF2) (AA 216-315) antibody (ABIN561522) Western Blot detection against Immunogen (36.74 KDa) .
Image no. 3 for anti-Interferon Regulatory Factor 2 (IRF2) (AA 216-315) antibody (ABIN561522) Immunofluorescence of monoclonal antibody to IRF2 on HeLa cell. (antibody concentrati...
Image no. 4 for anti-Interferon Regulatory Factor 2 (IRF2) (AA 216-315) antibody (ABIN561522) Immunoperoxidase of monoclonal antibody to IRF2 on formalin-fixed paraffin-embedded h...
Image no. 5 for anti-Interferon Regulatory Factor 2 (IRF2) (AA 216-315) antibody (ABIN561522) Immunofluorescence of monoclonal antibody to IRF2 on HeLa cell. [antibody concentrati...
Image no. 6 for anti-Interferon Regulatory Factor 2 (IRF2) (AA 216-315) antibody (ABIN561522) IRF2 monoclonal antibody (M02), clone 3B5 Western Blot analysis of IRF2 expression in...
Image no. 7 for anti-Interferon Regulatory Factor 2 (IRF2) (AA 216-315) antibody (ABIN561522) Detection limit for recombinant GST tagged IRF2 is approximately 0.1ng/ml as a captur...