ITPKB antibody (Inositol-Trisphosphate 3-Kinase B) (AA 545-643) Primary Antibody
ITPKB
Reactivity: Human
ELISA, WB
Host: Mouse
Monoclonal
2F8
camera_alt 3
(1)
Catalog No. ABIN561565
$440.00
Plus shipping costs $45.00
100 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 545-643
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Monoclonal
- Conjugate
- This ITPKB antibody is un-conjugated
- Application
- ELISA, Western Blotting (WB)
- Purpose
- Mouse monoclonal antibody raised against a partial recombinant ITPKB.
- Cross-Reactivity
- Human
- Immunogen
immunogen: ITPKB (NP_002212, 545 a.a. ~ 643 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: PELLPQDQDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPR
- Clone
- 2F8
- Isotype
- IgG2b kappa
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
-
Nalaskowski, Fliegert, Ernst, Brehm, Fanick, Windhorst, Lin, Giehler, Hein, Lin, Mayr: "Human inositol 1,4,5-trisphosphate 3-kinase isoform B (IP3KB) is a nucleocytoplasmic shuttling protein specifically enriched at cortical actin filaments and at invaginations of the nuclear envelope." in: The Journal of biological chemistry, Vol. 286, Issue 6, pp. 4500-10, 2011 (PubMed).
-
Nalaskowski, Fliegert, Ernst, Brehm, Fanick, Windhorst, Lin, Giehler, Hein, Lin, Mayr: "Human inositol 1,4,5-trisphosphate 3-kinase isoform B (IP3KB) is a nucleocytoplasmic shuttling protein specifically enriched at cortical actin filaments and at invaginations of the nuclear envelope." in: The Journal of biological chemistry, Vol. 286, Issue 6, pp. 4500-10, 2011 (PubMed).
-
- Target
- Alternative Name
- ITPKB (ITPKB Antibody Abstract)
- Synonyms
- 1110033J02Rik, E130307H12Rik, si:ch211-97m8.1, IP3-3KB, IP3K, IP3K-B, IP3KB, PIG37, inositol 1,4,5-trisphosphate 3-kinase B, inositol-trisphosphate 3-kinase B, Itpkb, ITPKB, itpkb, LOC698185
- Background
- Full Gene Name: inositol 1,4,5-trisphosphate 3-kinase B
Synonyms: IP3K,IP3K-B,IP3KB,PIG37 - Gene ID
- 3707
- NCBI Accession
- NP_002212, NM_002221
You are here: