Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Prostacyclin Receptor antibody (PTGIR) (AA 296-386) Primary Antibody

PTGIR Reactivity: Human IHC (p), ELISA, WB Host: Mouse Monoclonal 4B10 unconjugated
Catalog No. ABIN562512
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Prostacyclin Receptor (PTGIR)
    Binding Specificity
    • 15
    • 8
    • 8
    • 7
    • 7
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 296-386
    Reactivity
    • 51
    • 12
    • 2
    • 1
    • 1
    Human
    Host
    • 52
    • 3
    Mouse
    Clonality
    • 53
    • 2
    Monoclonal
    Conjugate
    • 22
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    This Prostacyclin Receptor antibody is un-conjugated
    Application
    • 33
    • 26
    • 21
    • 13
    • 13
    • 5
    • 4
    • 3
    • 1
    • 1
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant PTGIR.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: PTGIR (NP_000951, 296 a.a. ~ 386 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC

    Clone
    4B10
    Isotype
    IgG1 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Prostacyclin Receptor (PTGIR)
    Alternative Name
    PTGIR (PTGIR Antibody Abstract)
    Synonyms
    IP, PGI2, PRIPR, prostaglandin I receptor (IP), prostaglandin I2 receptor, Ptgir, PTGIR
    Background
    Full Gene Name: prostaglandin I2 (prostacyclin) receptor (IP)
    Synonyms: IP,MGC102830,PRIPR
    Gene ID
    5739
    NCBI Accession
    NP_000951, NM_000960
    Pathways
    cAMP Metabolic Process, Platelet-derived growth Factor Receptor Signaling, Thromboxane A2 Receptor Signaling
You are here:
help Support