FADD antibody (Fas (TNFRSF6)-Associated Via Death Domain) (AA 109-208)

Details for Product anti-FADD Antibody No. ABIN563780
Antigen
Epitope
AA 109-208
37
37
18
16
14
12
11
8
8
4
3
3
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human
204
103
42
9
1
Host
Mouse
221
47
Clonality (Clone)
Monoclonal ()
Conjugate
This FADD antibody is un-conjugated
11
7
6
6
6
6
6
6
5
4
4
4
3
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
219
117
83
36
21
16
15
9
8
4
4
2
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant FADD.
Immunogen

immunogen: FADD (AAH00334, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

Clone 3A12
Isotype IgG Mix lambda
Cross-Reactivity Human
Antigen
Alternative Name FADD (FADD Antibody Abstract)
Background Full Gene Name: Fas (TNFRSF6)-associated via death domain
Synonyms: GIG3,MGC8528,MORT1
Gene ID 8772
Pathways Apoptosis, TLR Signaling, Activation of Innate immune Response, Positive Regulation of Endopeptidase Activity, Toll-Like Receptors Cascades
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Fas (TNFRSF6)-Associated Via Death Domain (FADD) (AA 109-208) antibody (ABIN563780) FADD monoclonal antibody (M01), clone 3A12 Western Blot analysis of FADD expression i...
Image no. 2 for anti-Fas (TNFRSF6)-Associated Via Death Domain (FADD) (AA 109-208) antibody (ABIN563780) Detection limit for recombinant GST tagged FADD is approximately 0.03ng/ml as a captu...
Image no. 3 for anti-Fas (TNFRSF6)-Associated Via Death Domain (FADD) (AA 109-208) antibody (ABIN563780) Western Blot detection against Immunogen (36.63 KDa) .