RAMP1 antibody (Receptor (G Protein-Coupled) Activity Modifying Protein 1) (AA 27-117)

Details for Product anti-RAMP1 Antibody No. ABIN564453
Antigen
  • RAMP1
  • MGC147096
  • 9130218E19Rik
  • receptor activity modifying protein 1
  • receptor (G protein-coupled) activity modifying protein 1
  • receptor (calcitonin) activity modifying protein 1
  • RAMP1
  • ramp1
  • Ramp1
Epitope
AA 27-117
15
11
4
3
2
2
1
1
1
Reactivity
Human
65
34
32
Host
Mouse
59
7
4
2
Clonality (Clone)
Monoclonal ()
Conjugate
This RAMP1 antibody is un-conjugated
4
3
3
3
3
3
3
2
2
1
1
1
1
1
1
1
1
Application
ELISA
46
23
13
5
3
2
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant RAMP1.
Immunogen

immunogen: RAMP1 (NP_005846, 27 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS

Clone 1F1
Isotype IgG2b kappa
Cross-Reactivity Human
Plasmids, Primers & others Plasmids, Primers & others RAMP1 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name RAMP1 (RAMP1 Antibody Abstract)
Background Full Gene Name: receptor (G protein-coupled) activity modifying protein 1
Synonyms:
Gene ID 10267
NCBI Accession NP_005846, NM_005855
Pathways cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Carbohydrate Metabolic Process
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Receptor (G Protein-Coupled) Activity Modifying Protein 1 (RAMP1) (AA 27-117) antibody (ABIN564453) Detection limit for recombinant GST tagged RAMP1 is approximately 1ng/ml as a capture...
Did you look for something else?