Iba1 antibody (AA 99-133)

Catalog No. ABIN5647006

The Rabbit Polyclonal anti-Iba1 antibody is suitable to detect Iba1 in samples from Human. It has been validated for WB and IHC (p).

Quick Overview for Iba1 antibody (AA 99-133) (ABIN5647006)

Target: Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Iba1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-Iba1 Antibody

Binding Specificity: AA 99-133

Purpose: IBA1 Antibody / AIF-1

Sequence: ETFSYPDFLR MMLGKRSAIL KMILMYEEKA REKEK

Purification: Antigen affinity

Immunogen: Amino acids 99-133 (ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK) from the human protein were used as the immunogen for the IBA1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IBA1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the IBA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for Iba1

Target: Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))

Alternative Name: IBA1

Background: Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1 (IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.

UniProt: P55008

Pathways: Smooth Muscle Cell Migration