ATF6 antibody (AA 597-629)

Catalog No. ABIN5647025

The Rabbit Polyclonal anti-ATF6 antibody (ABIN5647025) specifically detects ATF6 in WB and IHC (p). The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for ATF6 antibody (AA 597-629) (ABIN5647025)

Target: ATF6 (Activating Transcription Factor 6 (ATF6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATF6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-ATF6 Antibody

Binding Specificity: AA 597-629

Purpose: ATF6 Antibody

Sequence: AININENVIN GQDYEVMMQI DCQVMDTRIL HIK

Purification: Antigen affinity

Immunogen: Amino acids 597-629 (AININENVINGQDYEVMMQIDCQVMDTRILHIK) from the human protein were used as the immunogen for the ATF6 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ATF6 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ATF6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ATF6

Target: ATF6 (Activating Transcription Factor 6 (ATF6))

Alternative Name: ATF6

Background: ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE).

UniProt: P18850

Pathways: ER-Nucleus Signaling, Unfolded Protein Response