Endoglin antibody (AA 258-297)

Catalog No. ABIN5647366

The Rabbit Polyclonal anti-Endoglin antibody has been validated for WB. It is suitable to detect Endoglin in samples from Human, Mouse and Rat.

Quick Overview for Endoglin antibody (AA 258-297) (ABIN5647366)

Target: Endoglin (ENG)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Endoglin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Endoglin Antibody

Binding Specificity: AA 258-297

Purification: Antigen affinity purified

Immunogen: Amino acids 258-297 (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ) from the human protein were used as the immunogen for the Endoglin antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Endoglin antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Endoglin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Endoglin

Target: Endoglin (ENG)

Alternative Name: CD105 / Endoglin

Background: Endoglin (Osler-Rendu-Weber syndrome 1), also called CD105, is a type I membrane glycoprotein located on cell surfaces and is a part of the TGF beta receptor complex. Its gene is mapped to human chromosome 8. The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts and smooth muscle cells. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling and has been found to be elevated in pregnant women who subsequently develop preeclampsia.

UniProt: P17813