JAK1 antibody (AA 78-115)

Catalog No. ABIN5647398

This Rabbit Polyclonal antibody specifically detects JAK1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for JAK1 antibody (AA 78-115) (ABIN5647398)

Target: JAK1 (Janus Kinase 1 (JAK1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JAK1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-JAK1 Antibody

Binding Specificity: AA 78-115

Purification: Antigen affinity purified

Immunogen: Amino acids 78-115 (FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN) from the human protein were used as the immunogen for the JAK1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the JAK1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the JAK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for JAK1

Target: JAK1 (Janus Kinase 1 (JAK1))

Alternative Name: JAK1

Background: JAK1 (Janus Kinase 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-a/b) and type II (IFN-g) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.

UniProt: P23458

Pathways: JAK-STAT Signaling, RTK Signaling, Interferon-gamma Pathway, Hepatitis C, Toll-Like Receptors Cascades, Unfolded Protein Response