SIX3 antibody (AA 1-32)

Catalog No. ABIN5647434

Product Details anti-SIX3 Antibody

Target: SIX3 (Sine Oculis-Related Homeobox 3 (SIX3))

Binding Specificity: AA 1-32

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIX3 antibody is un-conjugated

Application: Western Blotting (WB)

Cross-Reactivity (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogen: Amino acids 1-32 (MVFRSPLDLYSSHFLLPNFADSHHRSILLASS) were used as the immunogen for the Six3 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Six3 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Six3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SIX3

Target: SIX3 (Sine Oculis-Related Homeobox 3 (SIX3))

Alternative Name: Six3 (SIX3 Products)

Synonyms: HPE2 antibody, SIX3 antibody, cb347 antibody, six3.2 antibody, six6 antibody, E130112M24Rik antibody, Six3a antibody, Six3alpha antibody, Six3b antibody, Six3beta antibody, six3 antibody, six3.1 antibody, wu:fc10a08 antibody, SIX homeobox 3 antibody, SIX homeobox 3b antibody, sine oculis-related homeobox 3 antibody, SIX homeobox 3a antibody, sine oculis homeobox homolog 3 antibody, SIX3 antibody, six3b antibody, Six3 antibody, six3a antibody, six3 antibody

Background: Homeobox protein SIX3 is a protein that in humans is encoded by the SIX3 gene. This gene encodes a member of the sine oculishomeobox transcription factor family. The encoded protein plays a role in eye development. Mutations in SIX3 are the cause of a severe brain malformation, called holoprosencephaly type 2 (HPE2). In HPE2, the brain fails to separate into two hemispheres during early embryonic development, leading to eye and brain malformations, which result in serious facial abnormalities. A mutant zebrafish knockout model has been developed, in which the anterior part of the head was missing due to the atypical increase of Wnt1 activity. When injected with SIX3, these zebrafish embryos were able to successfully develop a normal forebrain. When SIX3 was turned off in mice, resulting in a lack of retina formation due to excessive expression of Wnt8b in the region where the forebrain normally develops. Both of these studies demonstrate the importance of SIX3 activity in brain and eye development.

UniProt: O95343

Pathways: Protein targeting to Nucleus