ACCN1 antibody (AA 112-147)

Catalog No. ABIN5647475

Product Details anti-ACCN1 Antibody

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Binding Specificity: AA 112-147

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACCN1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ACCN1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ACCN1

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Alternative Name: ACCN1 / ASIC2 (ACCN1 Products)

Synonyms: ACCN antibody, ACCN1 antibody, ASIC2a antibody, BNC1 antibody, BNaC1 antibody, MDEG antibody, hBNaC1 antibody, ACIC2 antibody, Accn1 antibody, BNaC1a antibody, Mdeg antibody, BNC1k antibody, MDEG1 antibody, MDEG2 antibody, accn1 antibody, zASIC2 antibody, acid sensing ion channel subunit 2 antibody, acid-sensing (proton-gated) ion channel 2 antibody, ASIC2 antibody, Asic2 antibody, asic2 antibody

Background: Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

UniProt: Q16515

Pathways: Sensory Perception of Sound