ACCN1 antibody (AA 112-147)

Catalog No. ABIN5647475

The Rabbit Polyclonal anti-ACCN1 antibody (ABIN5647475) specifically detects ACCN1 in WB. The antibody is reactive with Human and Rat samples.

Quick Overview for ACCN1 antibody (AA 112-147) (ABIN5647475)

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACCN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACCN1 Antibody

Binding Specificity: AA 112-147

Purpose: ACCN1 Antibody / ASIC2

Purification: Antigen affinity

Immunogen: Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody.

Isotype: IgG

Application Details

Application Notes: Differences in protocols and secondary/substrate sensitivity may require the ACCN1 antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ACCN1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ACCN1

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Alternative Name: ACCN1

Background: Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

UniProt: Q16515

Pathways: Sensory Perception of Sound