Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

BAX antibody (AA 17-48)

BAX Reactivity: Human, Mouse, Rat WB, FACS, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5647494
  • Target See all BAX Antibodies
    BAX (BCL2-Associated X Protein (BAX))
    Binding Specificity
    • 32
    • 25
    • 18
    • 16
    • 15
    • 12
    • 10
    • 9
    • 8
    • 6
    • 6
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 17-48
    Reactivity
    • 233
    • 147
    • 131
    • 45
    • 30
    • 24
    • 23
    • 18
    • 16
    • 10
    • 9
    • 5
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 149
    • 91
    • 3
    • 1
    Rabbit
    Clonality
    • 161
    • 83
    Polyclonal
    Conjugate
    • 124
    • 13
    • 11
    • 9
    • 7
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This BAX antibody is un-conjugated
    Application
    • 211
    • 93
    • 74
    • 55
    • 52
    • 52
    • 47
    • 34
    • 34
    • 11
    • 11
    • 8
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purification
    Antigen affinity purified
    Immunogen
    Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.
    Isotype
    IgG
    Top Product
    Discover our top product BAX Primary Antibody
  • Application Notes
    Optimal dilution of the Bax antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-2 μg/10^6 cells
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the Bax antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    BAX (BCL2-Associated X Protein (BAX))
    Alternative Name
    Bax (BAX Products)
    Background
    Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
    UniProt
    Q07812
    Pathways
    p53 Signaling, PI3K-Akt Signaling, Apoptosis, Caspase Cascade in Apoptosis, Positive Regulation of Endopeptidase Activity, Unfolded Protein Response
You are here:
Support