E2F4 antibody (AA 106-144)

Catalog No. ABIN5647555

Product Details anti-E2F4 Antibody

Target: E2F4 (E2F Transcription Factor 4, P107/p130-Binding (E2F4))

Binding Specificity: AA 106-144

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This E2F4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 106-144 (ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) from the human protein were used as the immunogen for the E2F4 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the E2F4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for E2F4

Target: E2F4 (E2F Transcription Factor 4, P107/p130-Binding (E2F4))

Alternative Name: E2F4 (E2F4 Products)

Synonyms: E2F-4 antibody, 2010111M04Rik antibody, AI427446 antibody, E2F4 antibody, e2f-4 antibody, fb72f07 antibody, wu:fb72f07 antibody, wu:fe05f06 antibody, zgc:63815 antibody, E2F transcription factor 4 antibody, E2F transcription factor 4 S homeolog antibody, E2F4 antibody, E2f4 antibody, e2f4.S antibody, e2f4 antibody

Background: E2F4 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two.

UniProt: Q16254

Pathways: Cell Division Cycle, Mitotic G1-G1/S Phases, Regulation of Cell Size