HCN2 antibody (AA 682-714)

Catalog No. ABIN5647571

The Rabbit Polyclonal anti-HCN2 antibody (ABIN5647571) specifically detects HCN2 in WB and IHC (p). The antibody is reactive with Rat and Mouse samples.

Quick Overview for HCN2 antibody (AA 682-714) (ABIN5647571)

Target: HCN2 (Hyperpolarization Activated Cyclic Nucleotide-Gated Potassium Channel 2 (HCN2))

Reactivity: Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HCN2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-HCN2 Antibody

Binding Specificity: AA 682-714

Purpose: HCN2 Antibody

Sequence: VFNNQENAII QEIVKYDREM VQQAELGQRV GLF

Cross-Reactivity (Details): Expected species reactivity: Human

Purification: Antigen affinity

Immunogen: Amino acids 682-714 (VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF) from the human protein were used as the immunogen for the HCN2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HCN2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the HCN2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for HCN2

Target: HCN2 (Hyperpolarization Activated Cyclic Nucleotide-Gated Potassium Channel 2 (HCN2))

Alternative Name: HCN2

Background: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated ion channel 2 is a protein that in humans is encoded by the HCN2 gene. The HCN2 gene is localized on human chromosome 19p13.3 and contains eight exons spanning approximately 27 kb. Hyperpolarization-activated cation channels of the HCN gene family, such as HCN2, contribute to spontaneous rhythmic activity in both heart and brain.

UniProt: Q9UL51