MAK antibody (AA 588-623)

Catalog No. ABIN5647592

The Rabbit Polyclonal anti-MAK antibody (ABIN5647592) specifically detects MAK in WB. The antibody is reactive with Human samples.

Quick Overview for MAK antibody (AA 588-623) (ABIN5647592)

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAK Antibody

Binding Specificity: AA 588-623

Purpose: MAK Antibody (C-Terminal Region)

Sequence: RTYNPTAKNL NIVNRAQPIP SVHGRTDWVA KYGGHR

Purification: Antigen affinity

Immunogen: Amino acids 588-623 (RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR) were used as the immunogen for the MAK antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MAK antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the MAK antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for MAK

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Alternative Name: MAK

Background: Serine/threonine-protein kinase MAK (Male germ cell-associated kinase) is an enzyme that in humans is encoded by the MAK gene. The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62.

UniProt: P20794