MAK antibody (AA 588-623)

Catalog No. ABIN5647592

Product Details anti-MAK Antibody

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Binding Specificity: AA 588-623

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAK antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 588-623 (RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR) were used as the immunogen for the MAK antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MAK antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the MAK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MAK

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Alternative Name: MAK / Male germ cell-associated kinase (MAK Products)

Synonyms: RP62 antibody, dJ417M14.2 antibody, A930010O05Rik antibody, Ick antibody, fj04c02 antibody, wu:fj04c02 antibody, zgc:56603 antibody, rp62 antibody, xmak antibody, MGC82717 antibody, MGC146434 antibody, male germ cell associated kinase antibody, male germ cell-associated kinase antibody, male germ cell associated kinase L homeolog antibody, MAK antibody, Mak antibody, mak antibody, mak.L antibody

Background: Serine/threonine-protein kinase MAK (Male germ cell-associated kinase) is an enzyme that in humans is encoded by the MAK gene. The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62.

UniProt: P20794