TECTA antibody (AA 93-134)

Catalog No. ABIN5647724

The Rabbit Polyclonal anti-TECTA antibody (ABIN5647724) specifically detects TECTA in WB and IHC (p). The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for TECTA antibody (AA 93-134) (ABIN5647724)

Target: TECTA (Tectorin alpha (TECTA))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TECTA antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-TECTA Antibody

Binding Specificity: AA 93-134

Purpose: TECTA Antibody / Alpha Tectorin

Sequence: RAFVAPFWAD VHNGIRGEIY YRETMEPAIL KRATKDIRKY FK

Purification: Antigen affinity

Immunogen: Amino acids 93-134 (RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK) from human Alpha Tectorin were used as the immunogen for the TECTA antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the TECTA antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the TECTA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for TECTA

Target: TECTA (Tectorin alpha (TECTA))

Alternative Name: TECTA

Background: Alpha Tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.

UniProt: O75443

Pathways: Sensory Perception of Sound