PDGFB antibody (AA 89-129)

Catalog No. ABIN5647896

This Rabbit Polyclonal antibody specifically detects PDGFB in WB. It exhibits reactivity toward Rat and Mouse.

Quick Overview for PDGFB antibody (AA 89-129) (ABIN5647896)

Target: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Reactivity: Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDGFB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDGFB Antibody

Binding Specificity: AA 89-129

Purpose: PDGF beta Antibody

Sequence: AEPAMIAECK TRTEVFEISR RLIDRTNANF LVWPPCVEVQ R

Cross-Reactivity (Details): Expected species reactivity: Human

Purification: Antigen affinity

Immunogen: Amino acids 89-129 (AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR) from the human protein were used as the immunogen for the PDGF beta antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PDGF beta antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the PDGF beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for PDGFB

Target: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Alternative Name: PDGF beta

Background: Platelet-derived growth factor subunit B is a protein that in humans is encoded by the PDGFB gene. The protein encoded by this gene is a member of the platelet-derived growth factor family. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. This gene is mapped to 22q13.1. Growth factor plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. This gene plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

UniProt: P01127

Pathways: RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling