ALDH7A1 antibody (AA 333-369)

Catalog No. ABIN5647986

Product Details anti-ALDH7A1 Antibody

Target: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Binding Specificity: AA 333-369

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH7A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 333-369 (ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY) from the human protein were used as the immunogen for the ALDH7A1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ALDH7A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ALDH7A1

Target: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Alternative Name: ALDH7A1 (ALDH7A1 Products)

Synonyms: atq1 antibody, ALDH7A1 antibody, ATQ1 antibody, EPD antibody, PDE antibody, antiquitin antibody, ATQ antibody, wu:fi34d12 antibody, wu:fi35e06 antibody, Atq1 antibody, D18Wsu181e antibody, aldehyde dehydrogenase 7 family member A1 antibody, aldehyde dehydrogenase 7 family member A1 L homeolog antibody, aldehyde dehydrogenase 7 family, member A1 antibody, aldehyde dehydrogenase family 7, member A1 antibody, ALDH7A1 antibody, aldh7a1 antibody, aldh7a1.L antibody, Aldh7a1 antibody

Background: Aldehyde dehydrogenase 7 family, member A1, also known as ALDH7A1 or antiquitin, is an enzyme that in humans is encoded by the ALDH7A1 gene. The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.

UniProt: P49419

Pathways: Sensory Perception of Sound