Post-GPI Attachment To Proteins 1 (PGAP1) (AA 168-266) antibody Primary Antibody
-
- Target
- Post-GPI Attachment To Proteins 1 (PGAP1)
- Binding Specificity
-
AA 168-266
- Reactivity
-
Human
- Host
- Mouse
- Clonality
- Polyclonal
- Application
-
ELISA, Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a partial recombinant PGAP1.
- Cross-Reactivity
- Human
- Immunogen
-
immunogen: PGAP1 (NP_079265, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag.
Immunogen Sequence: VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- 50 % glycerol
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
-
Liu, Ho, Tan, Kamran, Gasser: "Ras activation induces expression of Raet1 family NK receptor ligands." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 189, Issue 4, pp. 1826-34, 2012 (PubMed).
-
Liu, Ho, Tan, Kamran, Gasser: "Ras activation induces expression of Raet1 family NK receptor ligands." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 189, Issue 4, pp. 1826-34, 2012 (PubMed).
-
- Target
- Post-GPI Attachment To Proteins 1 (PGAP1)
- Alternative Name
- PGAP1 (PGAP1 Antibody Abstract)
- Synonyms
- Bst1, ISPD3024, 5033403E17Rik, 9030223K07Rik, A530084K22, D230012E17Rik, oto, bst1, post-GPI attachment to proteins 1, bone marrow stromal cell antigen 1, post-GPI attachment to proteins 1 L homeolog, Pgap1, PGAP1, Bst1, pgap1.L
- Background
-
Full Gene Name: post-GPI attachment to proteins 1
Synonyms: Bst1,FLJ42774,ISPD3024 - Gene ID
- 80055
- NCBI Accession
- NP_079265, NM_024989
- Pathways
- Sensory Perception of Sound, Inositol Metabolic Process