Post-GPI Attachment To Proteins 1 (PGAP1) (AA 168-266) antibody

Details for Product No. ABIN566418
Target
Binding Specificity
AA 168-266
3
1
1
1
1
Reactivity
Human
6
3
2
2
Host
Mouse
4
2
Clonality
Polyclonal
Application
ELISA, Western Blotting (WB)
6
4
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant PGAP1.
Immunogen

immunogen: PGAP1 (NP_079265, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL

Cross-Reactivity Human
Target
Alternative Name PGAP1 (PGAP1 Antibody Abstract)
Background Full Gene Name: post-GPI attachment to proteins 1
Synonyms: Bst1,FLJ42774,ISPD3024
Gene ID 80055
NCBI Accession NP_079265, NM_024989
Pathways Sensory Perception of Sound, Inositol Metabolic Process
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Post-GPI Attachment To Proteins 1 (PGAP1) (AA 168-266) antibody (ABIN566418) Western Blot detection against Immunogen (37 KDa) .
Product cited in: Liu, Ho, Tan, Kamran, Gasser: "Ras activation induces expression of Raet1 family NK receptor ligands." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 189, Issue 4, pp. 1826-34, 2012 (PubMed).