Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Post-GPI Attachment To Proteins 1 (PGAP1) (AA 168-266) antibody Primary Antibody

PGAP1 Reactivity: Human ELISA, WB Host: Mouse Polyclonal unconjugated
Pubmed (1)
Catalog No. ABIN566418
$305.71
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Post-GPI Attachment To Proteins 1 (PGAP1)
    Binding Specificity
    AA 168-266
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 7
    • 4
    • 3
    • 2
    Host
    Mouse
    Clonality
    Polyclonal
    Application
    ELISA, Western Blotting (WB)
    • 6
    • 5
    • 1
    • 1
    • 1
    Purpose
    Mouse polyclonal antibody raised against a partial recombinant PGAP1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: PGAP1 (NP_079265, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag.

    Immunogen Sequence: VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Liu, Ho, Tan, Kamran, Gasser: "Ras activation induces expression of Raet1 family NK receptor ligands." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 189, Issue 4, pp. 1826-34, 2012 (PubMed).

  • Target
    Post-GPI Attachment To Proteins 1 (PGAP1)
    Alternative Name
    PGAP1 (PGAP1 Antibody Abstract)
    Synonyms
    Bst1, ISPD3024, 5033403E17Rik, 9030223K07Rik, A530084K22, D230012E17Rik, oto, bst1, post-GPI attachment to proteins 1, bone marrow stromal cell antigen 1, post-GPI attachment to proteins 1 L homeolog, Pgap1, PGAP1, Bst1, pgap1.L
    Background
    Full Gene Name: post-GPI attachment to proteins 1
    Synonyms: Bst1,FLJ42774,ISPD3024
    Gene ID
    80055
    NCBI Accession
    NP_079265, NM_024989
    Pathways
    Sensory Perception of Sound, Inositol Metabolic Process
You are here:
help Support