Post-GPI Attachment To Proteins 1 (PGAP1) (AA 168-266) antibody

Catalog No. ABIN566418

Product Details

Target: Post-GPI Attachment To Proteins 1 (PGAP1)

See all Post-GPI Attachment To Proteins 1 (PGAP1) Antibodies

Binding Specificity: AA 168-266

See all available epitopes across PGAP1 antibodies

• Internal Region 3
• AA 168-266 1
• AA 168-267 1
• AA 211-260 1
• AA 40-120 1
• AA 90-122 1

Reactivity: Human

See all available reactivities across PGAP1 antibodies

• Human 7
• Mouse 4
• Rat 3
• Monkey 2

Host: Mouse

Clonality: Polyclonal

Application: ELISA, Western Blotting (WB)

See all available applications across PGAP1 antibodies

• ELISA 6
• Western Blotting (WB) 5
• Flow Cytometry (FACS) 1
• Immunofluorescence (IF) 1
• Immunohistochemistry (IHC) 1

Purpose: Mouse polyclonal antibody raised against a partial recombinant PGAP1.

Cross-Reactivity: Human

Immunogen:

immunogen: PGAP1 (NP_079265, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: 50 % glycerol

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Liu, Ho, Tan, Kamran, Gasser: "Ras activation induces expression of Raet1 family NK receptor ligands." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 189, Issue 4, pp. 1826-34, 2012 (PubMed).

Target Details

Target: Post-GPI Attachment To Proteins 1 (PGAP1)

Alternative Name: PGAP1 (PGAP1 Antibody Abstract)

Synonyms: Bst1, ISPD3024, 5033403E17Rik, 9030223K07Rik, A530084K22, D230012E17Rik, oto, bst1, post-GPI attachment to proteins 1, bone marrow stromal cell antigen 1, post-GPI attachment to proteins 1 L homeolog, Pgap1, PGAP1, Bst1, pgap1.L

Background: Full Gene Name: post-GPI attachment to proteins 1
Synonyms: Bst1,FLJ42774,ISPD3024

Gene ID: 80055

NCBI Accession: NP_079265, NM_024989

Pathways: Sensory Perception of Sound, Inositol Metabolic Process