NADPH Oxidase 4 antibody

Catalog No. ABIN5692899

Product Details anti-NADPH Oxidase 4 Antibody

Target: NADPH Oxidase 4 (NOX4)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NADPH Oxidase 4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Brand: Picoband™

Sequence: ILNTLLDDWK PYKLRRLYFI WVCRDIQSFR WFADLL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for NADPH oxidase 4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human NADPH oxidase 4 (ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

References for anti-NADPH Oxidase 4 antibody (ABIN5692899)

Liu, Hong, Li, Ren, Wang, Xu, Shi, Xu: "A Cross Talk Between BRG1 and Males Absent on the First Contributes to Reactive Oxygen Species Production in a Mouse Model of Nonalcoholic Steatohepatitis." in: Antioxidants & redox signaling, (2018) (PubMed).

Meyer, Fredette, Daniel, Sharma, Amann, Arterburn, Barton, Prossnitz: "Obligatory role for GPER in cardiovascular aging and disease." in: Science signaling, Vol. 9, Issue 452, pp. ra105, (2017) (PubMed).

Target Details for NADPH Oxidase 4

Target: NADPH Oxidase 4 (NOX4)

Alternative Name: NOX4 (NOX4 Products)

Synonyms: KOX antibody, KOX-1 antibody, RENOX antibody, AI648021 antibody, nox4 antibody, NOX4 antibody, NADPH oxidase 4 antibody, NOX4 antibody, Nox4 antibody, nox4 antibody, PTRG_09562 antibody

Background:

Synonyms: NADPH oxidase 4, Kidney oxidase-1, KOX-1, Kidney superoxide-producing NADPH oxidase, Renal NAD(P)H-oxidase, NOX4, RENOX

Tissue Specificity: Expressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, brain, several brain tumor cell lines and airway epithelial cells.

Background: NADPH oxidase 4 is an enzyme that in humans is encoded by the NOX4 gene, and is a member of the NOX family of NADPH oxidases. This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.

Pathways: Carbohydrate Homeostasis, Smooth Muscle Cell Migration