JunD antibody

Catalog No. ABIN5693269

Product Details anti-JunD Antibody

Target: JunD (JUND) (Jun D Proto-Oncogene (JUND))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JunD antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: TASLLREQVA QLKQKVLSHV NSGCQLLPQH QVPAY

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for JunD detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human JunD (TASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot,0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for JunD

Target: JunD (JUND) (Jun D Proto-Oncogene (JUND))

Alternative Name: JUND (JUND Products)

Synonyms: si:dkey-251j8.3 antibody, AP-1 antibody, Jund1 antibody, JunD proto-oncogene, AP-1 transcription factor subunit antibody, jun D proto-oncogene S homeolog antibody, jun D proto-oncogene antibody, jund antibody, jund.S antibody, JUND antibody, Jund antibody

Background:

Synonyms: Transcription factor jun-D, JUND

Background: Transcription factor JunD is a protein that in humans is encoded by the JUND gene. The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms.

UniProt: P17535