PML antibody (AA 141-179)

Catalog No. ABIN5708266

This anti-PML antibody is a Rabbit Polyclonal antibody detecting PML in WB and IHC (p). Suitable for Human, Mouse and Rat.

Quick Overview for PML antibody (AA 141-179) (ABIN5708266)

Target: PML (Promyelocytic Leukemia (PML))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PML antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-PML Antibody

Binding Specificity: AA 141-179

Purification: Antigen affinity purified

Immunogen: Amino acids 141-179 (FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD) from the human protein were used as the immunogen for the PML antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PML antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PML

Target: PML (Promyelocytic Leukemia (PML))

Alternative Name: PML / Promyelocytic leukemia protein

Background: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions, all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.

UniProt: P29590

Pathways: p53 Signaling, Retinoic Acid Receptor Signaling Pathway, Maintenance of Protein Location, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus