PML antibody (AA 140-177)

Catalog No. ABIN5708267

This Rabbit Polyclonal antibody specifically detects PML in WB and IHC (p). It exhibits reactivity toward Mouse.

Quick Overview for PML antibody (AA 140-177) (ABIN5708267)

Target: PML (Promyelocytic Leukemia (PML))

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PML antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-PML Antibody

Binding Specificity: AA 140-177

Purification: Antigen affinity purified

Immunogen: Amino acids 140-177 (LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN) from the mouse protein were used as the immunogen for the PML antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PML antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PML

Target: PML (Promyelocytic Leukemia (PML))

Alternative Name: PML / Promyelocytic leukemia protein

Background: Promyelocytic leukemia protein functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms.

UniProt: Q60953

Pathways: p53 Signaling, Retinoic Acid Receptor Signaling Pathway, Maintenance of Protein Location, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus