PRMT2 antibody (N-Term)

Catalog No. ABIN629611

This Rabbit Polyclonal antibody specifically detects PRMT2 in WB and IHC. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for PRMT2 antibody (N-Term) (ABIN629611)

Target: PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRMT2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PRMT2 Antibody

Binding Specificity: N-Term

Specificity: PRMT2 antibody was raised against the N terminal of PRMT2

Purification: Purified

Immunogen: PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL

Application Details

Application Notes: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRMT2 Blocking Peptide, (ABIN938128), is also available for use as a blocking control in assays to test for specificity of this PRMT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRMT2

Target: PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))

Alternative Name: PRMT2

Background: The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding