PSME3 antibody (C-Term)

Catalog No. ABIN629645

Product Details anti-PSME3 Antibody

Target: PSME3

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSME3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PSME3 antibody was raised against the C terminal of PSME3

Purification: Purified

Immunogen: PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSME3 Blocking Peptide, catalog no. 33R-9372, is also available for use as a blocking control in assays to test for specificity of this PSME3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSME3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSME3

Target: PSME3

Alternative Name: PSME3 (PSME3 Products)

Synonyms: AA410043 antibody, AU020960 antibody, Ki antibody, PA28gamma antibody, REGgamma antibody, pa28g antibody, Ab2-371 antibody, PA28-gamma antibody, PA28G antibody, REG-GAMMA antibody, psme3b antibody, proteaseome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) antibody, proteasome activator subunit 3 antibody, proteasome activator subunit 3 S homeolog antibody, Psme3 antibody, PSME3 antibody, psme3.S antibody

Background: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. PSME3 is the gamma subunit of the 11S regulator.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Positive Regulation of Endopeptidase Activity, Hepatitis C, Synthesis of DNA