IDH3A antibody

Catalog No. ABIN629675

Product Details anti-IDH3A Antibody

Target: IDH3A (Isocitrate Dehydrogenase 3 (NAD+) alpha (IDH3A))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IDH3A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: IDH3 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IDH3A Blocking Peptide, catalog no. 33R-6142, is also available for use as a blocking control in assays to test for specificity of this IDH3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IDH3A

Target: IDH3A (Isocitrate Dehydrogenase 3 (NAD+) alpha (IDH3A))

Alternative Name: IDH3A (IDH3A Products)

Synonyms: idh3a antibody, MGC76128 antibody, IDH3A antibody, zgc:56380 antibody, zgc:85631 antibody, BG1 antibody, 1110003P10Rik antibody, 1500012E04Rik antibody, AA407078 antibody, AI316514 antibody, isocitrate dehydrogenase 3 (NAD+) alpha antibody, isocitrate dehydrogenase 3 (NAD(+)) alpha antibody, isocitrate dehydrogenase 3 (NAD+) alpha S homeolog antibody, idh3a antibody, IDH3A antibody, idh3a.S antibody, Idh3a antibody

Background: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit.

Molecular Weight: 40 kDa (MW of target protein)