ADH4 antibody

Catalog No. ABIN629764

This Rabbit Polyclonal antibody specifically detects ADH4 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for ADH4 antibody (ABIN629764)

Target: ADH4 (Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADH4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-ADH4 Antibody

Purification: Purified

Immunogen: ADH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADH4 Blocking Peptide, (ABIN5611950), is also available for use as a blocking control in assays to test for specificity of this ADH4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADH4

Target: ADH4 (Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4))

Alternative Name: ADH4

Background: ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis