SGPP2 antibody (Sphingosine-1-Phosphate Phosphatase 2) (C-Term)

Details for Product anti-SGPP2 Antibody No. ABIN629768
Antigen
  • SPP2
  • RGD1565739
  • SPPase2
  • Spp2
  • sphingosine-1-phosphate phosphatase 2
  • sphingosine-1-phosphate phosphotase 2
  • SGPP2
  • Sgpp2
Epitope
C-Term
8
7
7
2
1
Reactivity
Human
23
6
2
2
2
1
1
1
Host
Rabbit
25
2
Clonality
Polyclonal
Conjugate
This SGPP2 antibody is un-conjugated
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Western Blotting (WB)
26
17
6
3
2
2
2
2
Options
Immunogen SGPP2 antibody was raised using the C terminal of SGPP2 corresponding to a region with amino acids SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL
Specificity SGPP2 antibody was raised against the C terminal of SGPP2
Purification Purified
Plasmids, Primers & others Plasmids, Primers & others SGPP2 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name SGPP2 (SGPP2 Antibody Abstract)
Background In vitro, SGPP2 has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P).
Molecular Weight 37 kDa (MW of target protein)
Application Notes WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SGPP2 Blocking Peptide, catalog no. 33R-8562, is also available for use as a blocking control in assays to test for specificity of this SGPP2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGPP2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Sphingosine-1-Phosphate Phosphatase 2 (SGPP2) (C-Term) antibody (ABIN629768) SGPP2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Image no. 2 for anti-Sphingosine-1-Phosphate Phosphatase 2 (SGPP2) (C-Term) antibody (ABIN629768) SGPP2 antibody used at 2.5 ug/ml to detect target protein.
Did you look for something else?