CES1 antibody

Catalog No. ABIN629786

Product Details anti-CES1 Antibody

Target: CES1 (Carboxylesterase 1 (CES1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CES1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: Carboxylesterase 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxylesterase 1 Blocking Peptide, catalog no. 33R-9660, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CES1

Target: CES1 (Carboxylesterase 1 (CES1))

Alternative Name: Carboxylesterase 1 (CES1 Products)

Synonyms: ACAT antibody, CE-1 antibody, CEH antibody, CES2 antibody, HMSE antibody, HMSE1 antibody, PCE-1 antibody, REH antibody, SES1 antibody, TGH antibody, hCE-1 antibody, CESDD1 antibody, CES1 antibody, CES-K1 antibody, APLE antibody, PMPMEase antibody, CES antibody, carboxylesterase 1 antibody, liver carboxylesterase 1 antibody, liver carboxylesterase antibody, carboxylesterase 1 (monocyte/macrophage serine esterase 1) antibody, CES1 antibody, CpipJ_CPIJ013026 antibody, CpipJ_CPIJ016339 antibody, LOC100009551 antibody, LOC454097 antibody, LOC699486 antibody, LOC100050915 antibody

Background: CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process