SLC38A4 antibody (Middle Region)

Catalog No. ABIN629787

Product Details anti-SLC38A4 Antibody

Target: SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), C. elegans, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC38A4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SLC38 A4 antibody was raised against the middle region of SLC38 4

Purification: Purified

Immunogen: SLC38 A4 antibody was raised using the middle region of SLC38 4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC38A4 Blocking Peptide, catalog no. 33R-4755, is also available for use as a blocking control in assays to test for specificity of this SLC38A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC38A4

Target: SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))

Alternative Name: SLC38A4 (SLC38A4 Products)

Synonyms: wu:fd51c05 antibody, zgc:103694 antibody, zgc:113830 antibody, SLC38A4 antibody, ATA3 antibody, SNAT4 antibody, NAT3 antibody, PAAT antibody, 1110012E16Rik antibody, 1700012A18Rik antibody, Ata3 antibody, mATA3 antibody, mNAT3 antibody, solute carrier family 38, member 4 antibody, solute carrier family 38 member 4 antibody, slc38a4 antibody, SLC38A4 antibody, Slc38a4 antibody

Background: SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Molecular Weight: 17 kDa (MW of target protein)