TARS antibody (N-Term)

Catalog No. ABIN629800

Product Details anti-TARS Antibody

Target: TARS (threonyl-tRNA Synthetase (TARS))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TARS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: TARS antibody was raised against the N terminal of TARS

Purification: Purified

Immunogen: TARS antibody was raised using the N terminal of TARS corresponding to a region with amino acids PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TARS Blocking Peptide, catalog no. 33R-7067, is also available for use as a blocking control in assays to test for specificity of this TARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TARS

Target: TARS (threonyl-tRNA Synthetase (TARS))

Alternative Name: TARS (TARS Products)

Synonyms: ThrRS antibody, wu:fb07c05 antibody, wu:fb39c12 antibody, zgc:92586 antibody, 42/3 antibody, CG5353 antibody, Dmel\\CG5353 antibody, P539 antibody, TRS antibody, l(2)k04203 antibody, threonyl-tRNA synthetase antibody, tarsl2 antibody, TARS antibody, D15Wsu59e antibody, threonyl-tRNA synthetase L homeolog antibody, threonyl-tRNA synthetase antibody, Threonyl-tRNA synthetase antibody, threonyl-tRNA synthetase 2, mitochondrial (putative) antibody, tars.L antibody, tars antibody, TARS antibody, ThrRS antibody, thrS antibody, tars2 antibody, Tars antibody

Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Threonyl-tRNA synthetase belongs to the class-II aminoacyl-tRNA synthetase family.

Molecular Weight: 78 kDa (MW of target protein)