MAGEA1 antibody
-
- Target See all MAGEA1 Antibodies
- MAGEA1 (Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAGEA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- MAGEA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE
- Top Product
- Discover our top product MAGEA1 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAGEA1 Blocking Peptide, catalog no. 33R-6107, is also available for use as a blocking control in assays to test for specificity of this MAGEA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEA1 (Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1))
- Alternative Name
- MAGEA1 (MAGEA1 Products)
- Background
- The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.
- Molecular Weight
- 34 kDa (MW of target protein)
-