MAGEA1 antibody

Catalog No. ABIN629810

The Rabbit Polyclonal anti-MAGEA1 antibody has been validated for WB. It is suitable to detect MAGEA1 in samples from Human.

Quick Overview for MAGEA1 antibody (ABIN629810)

Target: MAGEA1 (Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAGEA1 Antibody

Purification: Purified

Immunogen: MAGEA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEA1 Blocking Peptide, (ABIN5614629), is also available for use as a blocking control in assays to test for specificity of this MAGEA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEA1

Target: MAGEA1 (Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1))

Alternative Name: MAGEA1

Background: The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Molecular Weight: 34 kDa (MW of target protein)