PRMT1 antibody (Middle Region)

Catalog No. ABIN629816

Product Details anti-PRMT1 Antibody

Target: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRMT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PRMT1 antibody was raised against the middle region of PRMT1

Purification: Purified

Immunogen: PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRMT1 Blocking Peptide, catalog no. 33R-2736, is also available for use as a blocking control in assays to test for specificity of this PRMT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRMT1

Target: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Alternative Name: PRMT1 (PRMT1 Products)

Synonyms: ANM1 antibody, HCP1 antibody, HRMT1L2 antibody, IR1B4 antibody, 6720434D09Rik antibody, AW214366 antibody, Hrmt1l2 antibody, Mrmt1 antibody, 3E10 antibody, anm1 antibody, hcp1 antibody, hrmt1l2 antibody, ir1b4 antibody, prmt1 antibody, prmt1b antibody, xPRMT1b antibody, xprmt1 antibody, xPRMT1 antibody, ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 1A antibody, ATPRMT1A antibody, F6F22.30 antibody, F6F22_30 antibody, protein arginine methyltransferase 1A antibody, DDBDRAFT_0183976 antibody, DDBDRAFT_0235399 antibody, DDB_0183976 antibody, DDB_0235399 antibody, PRMT1 antibody, DKFZp459J1326 antibody, fb39h07 antibody, wu:fb39h07 antibody, zf1 antibody, zgc:66201 antibody, protein arginine methyltransferase 1 antibody, protein arginine N-methyltransferase 1 antibody, protein arginine methyltransferase 1 L homeolog antibody, protein arginine methyltransferase 1 S homeolog antibody, protein arginine methyltransferase 1A antibody, protein arginine N-methyltransferase-1 antibody, protein arginine N-methyltransferase antibody, protein arginine methyltransferase antibody, PRMT1 antibody, Prmt1 antibody, prmt1.L antibody, prmt1.S antibody, PRMT1A antibody, prm-1 antibody, EDI_007800 antibody, Smp_029240.3 antibody, prmt1 antibody

Background: PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4.

Molecular Weight: 40 kDa (MW of target protein)