Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M) (N-Term) antibody

Catalog No. ABIN629825

Product Details

Target: Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: EIF3 M antibody was raised against the N terminal of EIF3

Purification: Purified

Immunogen: EIF3 M antibody was raised using the N terminal of EIF3 corresponding to a region with amino acids MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF3M Blocking Peptide, catalog no. 33R-6523, is also available for use as a blocking control in assays to test for specificity of this EIF3M antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M)

Alternative Name: EIF3M (EIF3M Products)

Synonyms: ga17 antibody, pcid1 antibody, hfl-b5 antibody, tango7 antibody, MGC69424 antibody, PCID1 antibody, DKFZp459D197 antibody, Ga17 antibody, Pcid1 antibody, Tango7 antibody, B5 antibody, TANGO7 antibody, hfl-B5 antibody, GA17 antibody, fa16c10 antibody, wu:fa16c10 antibody, wu:fc41f09 antibody, zgc:63996 antibody, HFL-B5 antibody, RGD1565840 antibody, eukaryotic translation initiation factor 3 subunit M antibody, eukaryotic translation initiation factor 3, subunit M antibody, eukaryotic translation initiation factor 3 subunit M S homeolog antibody, eif3m antibody, EIF3M antibody, Eif3m antibody, eif3m.S antibody

Target Type: Viral Protein

Background: EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization