MORF4L1 antibody (Middle Region)

Catalog No. ABIN629857

Product Details anti-MORF4L1 Antibody

Target: MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MORF4L1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: MORF4 L1 antibody was raised against the middle region of MORF4 1

Purification: Purified

Immunogen: MORF4 L1 antibody was raised using the middle region of MORF4 1 corresponding to a region with amino acids YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ

Application Details

Application Notes: WB: 5-10 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MORF4L1 Blocking Peptide, catalog no. 33R-10055, is also available for use as a blocking control in assays to test for specificity of this MORF4L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MORF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MORF4L1

Target: MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))

Alternative Name: MORF4L1 (MORF4L1 Products)

Synonyms: Eaf3 antibody, HsT17725 antibody, MEAF3 antibody, MORFRG15 antibody, MRG15 antibody, S863-6 antibody, TEG-189 antibody, Tex189 antibody, mKIAA4002 antibody, MORF4L2 antibody, CG6363 antibody, DmMRG15 antibody, Dmel\\CG6363 antibody, Dmrg15 antibody, Mrg15 antibody, dMRG15 antibody, dMrg15 antibody, l(3)j6A3 antibody, zgc:92289 antibody, mortality factor 4 like 1 antibody, MORF-related gene 15 antibody, MRG15 antibody, mortality factor 4 like 1 S homeolog antibody, MORF4L1 antibody, Morf4l1 antibody, MRG15 antibody, CpipJ_CPIJ013367 antibody, morf4l1.S antibody, morf4l1 antibody

Background: MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Chromatin Binding